BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0755 (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2A9.10 |||Bin3 family|Schizosaccharomyces pombe|chr 2|||Manual 26 6.1 SPAC1039.01 |||amino acid permease, unknown 5|Schizosaccharomyce... 25 8.0 >SPBC2A9.10 |||Bin3 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 268 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 335 PAAIEIRLKLIGIISLYTIMIVIYNSIITNFAKATL 442 P A E L G++ Y+I + NS NFAK T+ Sbjct: 216 PDAFEHLLNQAGLVLEYSIEPQVNNSEYKNFAKRTM 251 >SPAC1039.01 |||amino acid permease, unknown 5|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 248 LLNYLCFRSNANFTGQIISWTSVLY 174 ++ LCF S N T Q ++WT ++Y Sbjct: 484 MIPILCFPSVKNPTAQEMNWTCLVY 508 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,866,276 Number of Sequences: 5004 Number of extensions: 59107 Number of successful extensions: 130 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -