BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0755 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0085 - 19905784-19906510,19907428-19907557,19907739-19907874 30 1.6 01_05_0584 + 23435620-23436408,23436966-23437508 28 8.4 >11_06_0085 - 19905784-19906510,19907428-19907557,19907739-19907874 Length = 330 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -2 Query: 403 NYNHNSIQTYNSN*F*SNFDCCGTSSPNKYNNSPKPRNTRNY 278 +++H+S QT S+ SN T+SPN YN + N+ NY Sbjct: 130 HHHHHSFQTTPSS---SNAAAVATTSPNYYNPNNSNSNSSNY 168 >01_05_0584 + 23435620-23436408,23436966-23437508 Length = 443 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/68 (29%), Positives = 29/68 (42%) Frame = +1 Query: 28 SNIICSIRITKLTL*HRDLYKRRVNCEKTHNLLGNTPTRRIARCPTLIIYRTLVQLMICP 207 S+++CS+ + +Y V + T NL RIA TLI L+I P Sbjct: 268 SSVLCSLNYAVTAVLGYKIYGEDVQAQVTLNLPTGKLYTRIAILTTLITPLAKYALVIQP 327 Query: 208 VKLAFDRK 231 V A + K Sbjct: 328 VTTAIEEK 335 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,736,743 Number of Sequences: 37544 Number of extensions: 311320 Number of successful extensions: 547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -