BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0755 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38205| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 29 2.8 >SB_38205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 31.1 bits (67), Expect = 0.92 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = -1 Query: 143 RVGVFPSKLWVFSQFTRRLYRSRCQSVSFVIRIEHIILDCVYL 15 R V P+K + S TRR ++ + +S + ++++I++CVYL Sbjct: 161 RTCVVPAKYSLRSGTTRRTQMTKTKRLSDFVTVKYLIVNCVYL 203 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 5/70 (7%) Frame = +1 Query: 25 QSNIICSIRITKLTL*H--RDLYKRRVNCEKTHNLLGNTPTRRIARCPTLIIYRTLVQLM 198 ++NIICS+ I K + H RD + +C +L N R+ +C + + + ++ M Sbjct: 35 EANIICSVAIGKEDISHNNRDPLEYHCSCAGI-GVLANQHHLRVHKCRDVSLKKDAIKTM 93 Query: 199 I---CPVKLA 219 + CP K A Sbjct: 94 LNHQCPTKSA 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,683,964 Number of Sequences: 59808 Number of extensions: 422655 Number of successful extensions: 865 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -