BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0752 (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0931 - 26052135-26052176,26052273-26052377,26052489-260525... 28 7.3 01_06_1317 - 36251231-36251341,36252514-36252609,36252879-362529... 28 7.3 >06_03_0931 - 26052135-26052176,26052273-26052377,26052489-26052584, 26052686-26052757,26052879-26052974,26053054-26053155, 26053258-26053347,26053452-26053535,26053623-26053697, 26053847-26053930,26054012-26054242 Length = 358 Score = 27.9 bits (59), Expect = 7.3 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 233 RNAAVAVNRVRHMRNSCDGMFVRLVHF*-FQNETIKRTNAPVRSVVYVILYVPC 391 RNA +A + + +R + V+L F Q +KR AP +SVV+ L++ C Sbjct: 196 RNAFLAASCILFVR----AVLVQLAFFAHMQQHVLKRPLAPTKSVVFATLFMCC 245 >01_06_1317 - 36251231-36251341,36252514-36252609,36252879-36252956, 36253037-36253138,36254509-36254784 Length = 220 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 70 IYTLRRGGDFCDWTHKFFGPGNFKIFHMFIGFA 168 I+ ++R C W + G N+KIF +F+ +A Sbjct: 86 IHEIKRKDHHCIWINNCVGHENYKIFLVFVLYA 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,865,952 Number of Sequences: 37544 Number of extensions: 208865 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -