BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0752 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 28 7.5 SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = -1 Query: 174 ATRKTNEHMKNFKISRTKKFMRPITKVSSSPQCIYVKLLTGQDIYERWIDTSD 16 AT K+N+ ++ + T + + + + PQC + G+D+ + DT D Sbjct: 442 ATSKSNQGVRKAEEKGTHQIDVQVMESTDIPQCHATNAIAGEDVKAKKEDTED 494 >SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2142 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -1 Query: 168 RKTNEHMKNFKISRTKKFMRPITKVSSSPQCIYVKLL 58 +K E ++N +S + +++V SSP +++KLL Sbjct: 1002 KKAAEELENKNLSNVWTILETMSQVDSSPHHVFLKLL 1038 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,998,089 Number of Sequences: 59808 Number of extensions: 277028 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -