BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0751 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.19 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 3.1 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 3.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.19 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 194 NQGKGSIIQNVVNNLIIDGSRTPWSTATSCGSATDSTLSESTSPITLD 337 NQG+ + Q N L + W T C ST++ ST+P+ D Sbjct: 2256 NQGQLQL-QVCPNGLFWNKDHCDWPENTECHPDASSTMAPSTTPMVPD 2302 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +2 Query: 263 WSTATSCGSATDSTLSESTSPITLDSSWP 349 W+T T+ + T + ST+ ++WP Sbjct: 1052 WTTTTTRRTTTTRPTTTSTTTRPTTTNWP 1080 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +1 Query: 325 YNFRLIMAGNFVKLIYRNYNLALKLGPTLDPANERLAYGDGKEKN 459 Y L V L + YNL+L + D N + +EKN Sbjct: 169 YTLHLFCVLYVVLLHFLTYNLSLGIKLRYDDVNNLFRIEESEEKN 213 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +1 Query: 325 YNFRLIMAGNFVKLIYRNYNLALKLGPTLDPANERLAYGDGKEKN 459 Y L V L + YNL+L + D N + +EKN Sbjct: 169 YTLHLFCVLYVVLLHFLTYNLSLGIKLRYDDVNNLFRIEESEEKN 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,293 Number of Sequences: 336 Number of extensions: 2897 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -