BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0751 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0206 - 18493178-18495310 28 6.1 10_01_0117 + 1447741-1449123 28 8.0 01_01_0758 + 5843702-5843874,5844021-5844083,5844174-5844290,584... 28 8.0 >03_04_0206 - 18493178-18495310 Length = 710 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 145 DAVVQFLLEFFVRTAHAYRGHFSDAGADGEHARREHHEKF 26 + V ++ + H YRG+F D + E R+E + KF Sbjct: 364 NTVCNEIIHLHDKNLHVYRGNFDDFESGYEQKRKEMNRKF 403 >10_01_0117 + 1447741-1449123 Length = 460 Score = 27.9 bits (59), Expect = 8.0 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = -3 Query: 301 AVRCRPTACSSTPWCSTSVNDQVVNYILDDGALALVLVFQALTDSAVVVTGEDAVVQFLL 122 A R A +S P S S + V +LDD ALVLV L + A+V G A LL Sbjct: 164 AARALAAAVASFPAASDSASASSV--LLDDVLAALVLV-MPLDEEAIVAIGSSAASVALL 220 >01_01_0758 + 5843702-5843874,5844021-5844083,5844174-5844290, 5847180-5847945 Length = 372 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 385 LALKLGPTLDPANERLAYGDGKEKNS 462 +AL GP L P N A+G G E S Sbjct: 146 IALYSGPALSPLNHHRAFGGGAESGS 171 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,746,282 Number of Sequences: 37544 Number of extensions: 326086 Number of successful extensions: 973 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -