BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0746 (534 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.15 |||ketoreductase |Schizosaccharomyces pombe|chr 1|||M... 25 5.4 SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces ... 25 7.1 >SPAC4G9.15 |||ketoreductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 341 Score = 25.4 bits (53), Expect = 5.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 499 IPALGSWCGLLVSPXKNARXXATAFSMKWS 410 I +GS+ GLL SP + + AF WS Sbjct: 198 ILTMGSFAGLLPSPYLSTYAGSKAFLSNWS 227 >SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 25.0 bits (52), Expect = 7.1 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 270 VCYVTLPGGX-CFXSFQNCPTKAEARXSAAKIALMNSV 380 +C+ T G CF F+N P EA + + L +S+ Sbjct: 455 LCFRTKGNGPMCFVEFENIPYAMEALKNLQGVCLSSSI 492 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,226,839 Number of Sequences: 5004 Number of extensions: 13150 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -