BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0744 (302 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59062| Best HMM Match : Brevenin (HMM E-Value=0.39) 27 2.9 SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 26 6.7 SB_38695| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.9 >SB_59062| Best HMM Match : Brevenin (HMM E-Value=0.39) Length = 214 Score = 27.1 bits (57), Expect = 2.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 129 SSKPCFLSSCXRPHLVNVLASEPTQRTTKAKIINFCISIVS 7 SS PC+ RP L ++ + Q T A +I CI +++ Sbjct: 43 SSTPCWHILKDRPRLCEIIHGQKAQYTIIALVIIDCIIVIA 83 >SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1145 Score = 25.8 bits (54), Expect = 6.7 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = -3 Query: 147 QXLMRXSSK-PCFL--SSCXRPHLVNVLASEPTQRTTKAKIINFCIS 16 Q L+ K PC SC + + +V A E Q TT AK ++ C S Sbjct: 111 QSLISEDEKLPCLSVKKSCFKEGIASVPAKETDQVTTTAKDVSDCCS 157 >SB_38695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 25.4 bits (53), Expect = 8.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 209 GSXDYGLFQINDRYWSAKAPVQAKT 283 G+ DYG+ ++ R W+ + VQ K+ Sbjct: 88 GTGDYGIRGVHCRLWNQEGAVQGKS 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,016,206 Number of Sequences: 59808 Number of extensions: 93413 Number of successful extensions: 192 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 192 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 364677581 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -