BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0743 (794 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0747 - 26867114-26867225,26868443-26868531,26869342-268693... 31 0.80 06_03_0262 + 18905352-18905481,18905570-18906003,18906082-189063... 31 0.80 04_03_0421 - 15725045-15725193,15725528-15725599,15725709-157257... 31 0.80 04_03_0412 - 15595781-15596081,15596161-15596331,15596414-155972... 31 0.80 06_03_0771 + 24473176-24473203,24473292-24474025,24474104-244745... 31 1.1 06_02_0270 - 13613853-13614153,13614233-13614403,13614486-136153... 31 1.1 06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121,963... 31 1.1 05_07_0218 + 28470325-28470454,28470543-28471276,28471355-284718... 31 1.1 05_05_0143 + 22675463-22675592,22676227-22676414,22676492-226766... 31 1.1 02_05_0268 - 27302734-27303034,27303114-27303284,27303367-273041... 31 1.1 01_02_0132 + 11444480-11444609,11444698-11445131,11445210-114454... 31 1.1 12_02_0938 - 24576419-24576719,24576817-24576969,24577052-245778... 31 1.4 12_02_0311 + 17361153-17361282,17361371-17362104,17362183-173626... 31 1.4 12_02_0096 - 13573612-13573632,13573846-13573884,13574160-135744... 31 1.4 12_01_0775 - 7070620-7070920,7071000-7071170,7071253-7072085,707... 31 1.4 12_01_0705 + 6065932-6066061,6066150-6066883,6066962-6067423,606... 31 1.4 11_06_0576 - 25127807-25128107,25128241-25128357,25128730-251292... 31 1.4 11_04_0390 - 17108441-17108654,17108821-17108991,17109074-171091... 31 1.4 11_01_0582 - 4632377-4632677,4632757-4632927,4633010-4633842,463... 31 1.4 10_05_0091 - 9085506-9085758,9085838-9085992,9086091-9086132,908... 31 1.4 10_03_0045 - 7353148-7353448,7353528-7353698,7353781-7354613,735... 31 1.4 08_02_1612 + 28226138-28226267,28226356-28227089,28227168-282276... 31 1.4 08_02_1391 + 26668539-26668668,26668757-26669490,26669569-266700... 31 1.4 08_02_0942 - 22845270-22845570,22845650-22845820,22845903-228467... 31 1.4 08_02_0778 + 21119812-21119941,21120030-21120463,21120576-211206... 31 1.4 08_02_0712 - 20329967-20330267,20330347-20330517,20330600-203314... 31 1.4 08_02_0331 - 15852164-15852464,15852544-15852714,15852797-158536... 31 1.4 08_02_0327 + 15821587-15821716,15821805-15822538,15822617-158230... 31 1.4 07_03_1513 - 27327702-27328604,27329957-27329995,27330413-273306... 31 1.4 07_03_0783 + 21501013-21501142,21501231-21501964,21502043-215025... 31 1.4 07_03_0729 - 21025525-21025825,21025905-21026075,21026158-210269... 31 1.4 07_03_0422 + 18015230-18015359,18015448-18016181,18016260-180167... 31 1.4 07_03_0139 + 14143383-14143512,14143601-14144334,14144413-141448... 31 1.4 07_03_0052 - 12833004-12833057,12833917-12833955,12834231-128346... 31 1.4 07_01_0943 - 7959813-7960113,7960193-7960363,7960446-7961278,796... 31 1.4 07_01_0811 - 6377328-6377628,6377708-6377878,6377961-6378145,637... 31 1.4 06_03_0463 - 21038166-21038466,21038546-21038716,21038799-210396... 31 1.4 06_03_0249 + 18700299-18700769,18700848-18701309,18701391-187022... 31 1.4 06_01_1107 + 9120664-9120793,9120882-9121615,9121694-9123069,912... 31 1.4 05_07_0085 - 27591909-27592152,27592232-27592402,27592485-275926... 31 1.4 05_03_0464 + 14350391-14350520,14350609-14351342,14351421-143518... 31 1.4 05_03_0399 + 13517874-13518003,13518092-13518825,13518904-135193... 31 1.4 04_04_0899 - 29229812-29229929,29230009-29230179,29230262-292310... 31 1.4 04_04_0067 + 22498987-22499116,22499205-22499938,22500017-225004... 31 1.4 04_03_0574 - 17338777-17339077,17339390-17340222,17340304-173407... 31 1.4 04_03_0262 + 13597021-13597150,13597239-13597972,13598051-135985... 31 1.4 04_02_0023 + 8655524-8655653,8655742-8656475,8656553-8656918,865... 31 1.4 04_01_0606 - 7949609-7949822,7949989-7950159,7950242-7951074,795... 31 1.4 04_01_0224 - 2830669-2830969,2831049-2831219,2831302-2832134,283... 31 1.4 04_01_0118 - 1223530-1223830,1223910-1224080,1224163-1224995,122... 31 1.4 04_01_0048 + 522423-522552,522641-523374,523453-524828,528100-52... 31 1.4 03_06_0623 + 35160081-35160210,35160299-35161032,35161111-351615... 31 1.4 02_03_0337 + 17898732-17899370,17899516-17899977,17900058-179006... 31 1.4 02_01_0601 + 4465775-4465924,4466070-4466531,4466613-4467445,446... 31 1.4 01_03_0195 - 13674138-13674438,13674518-13674688,13674771-136756... 31 1.4 12_01_0801 + 7351171-7351198,7351383-7352020,7352098-7352559,735... 30 2.4 08_01_0258 - 2112170-2112470,2112550-2112720,2112803-2113635,211... 30 2.4 07_01_1087 - 9959933-9960212,9960292-9960462,9960545-9961365,996... 30 2.4 11_08_0016 + 27652728-27653011,27653105-27653198,27653277-276537... 29 3.2 06_03_1348 - 29497084-29497384,29497464-29497634,29497717-294985... 29 4.3 01_06_1389 - 36969414-36969436,36970027-36970394,36970474-369706... 29 4.3 12_02_0969 - 24936399-24936699,24936779-24936949,24937032-249378... 29 5.6 10_08_0786 - 20540061-20542106 29 5.6 03_04_0008 - 16274158-16274458,16274791-16275623,16275706-162761... 29 5.6 02_04_0153 - 20330775-20330831,20330913-20330999,20333119-203331... 29 5.6 07_01_0431 + 3283252-3283274,3283684-3283819,3285839-3286682,328... 28 7.4 01_03_0214 + 13863123-13863593,13863671-13864132,13864308-138650... 28 7.4 06_02_0289 + 13825103-13825510,13825651-13826112,13826189-138270... 28 9.8 >11_06_0747 - 26867114-26867225,26868443-26868531,26869342-26869380, 26869819-26870077,26870157-26870327,26870410-26870451, 26870896-26871242,26871324-26871785,26871864-26872597, 26872686-26872815 Length = 794 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDACKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >06_03_0262 + 18905352-18905481,18905570-18906003,18906082-18906303, 18906381-18906842,18906935-18907755,18907838-18908008, 18908088-18908347,18908453-18908508,18908786-18908824, 18909711-18909764 Length = 882 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 481 TLGDACKTFIQWPKEDIVVKMTPRPSRPTELTP 513 >04_03_0421 - 15725045-15725193,15725528-15725599,15725709-15725784, 15728607-15728679,15728919-15728983,15729423-15729681, 15729761-15729931,15730014-15730846,15731097-15731390, 15731469-15731939 Length = 820 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 324 TLGDACKTFIQWPKEDIVVKMTPRPSRPTELTP 356 >04_03_0412 - 15595781-15596081,15596161-15596331,15596414-15597246, 15597369-15597788,15597867-15598337 Length = 731 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 366 TLGDACKTFIQWPKEDIVVKMTPRPSRPTELTP 398 >06_03_0771 + 24473176-24473203,24473292-24474025,24474104-24474565, 24474647-24475479,24475562-24475732,24475812-24476112 Length = 842 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP+ L P Sbjct: 477 TLGDARKTFIQWPKEDIVVKMTPRPSRPMELTP 509 >06_02_0270 - 13613853-13614153,13614233-13614403,13614486-13615318, 13615401-13615746,13615940-13616127,13616238-13616408 Length = 669 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP+ L P Sbjct: 304 TLGDARKTFIQWPKEDIVVKMTPRPSRPMELTP 336 >06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121, 9631203-9632035,9632118-9632288,9632368-9632668 Length = 876 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G KT + P ++ ++TPRPSRP L P K S Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTPPKCKLS 549 >05_07_0218 + 28470325-28470454,28470543-28471276,28471355-28471816, 28471898-28472730,28472813-28472983,28473063-28473180 Length = 815 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G KT + P ++ ++TPRPSRP L P K S Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTPPKCKLS 549 >05_05_0143 + 22675463-22675592,22676227-22676414,22676492-22676649, 22676656-22676953,22677035-22677867,22677950-22678120, 22678242-22678458,22678911-22678949,22679167-22679226 Length = 697 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P +I ++TPRPSRP L P Sbjct: 327 TLGDARKTFIQWPKEDIIVKMTPRPSRPTELTP 359 >02_05_0268 - 27302734-27303034,27303114-27303284,27303367-27304199, 27304281-27304742,27304821-27305554,27305643-27305772 Length = 876 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G KT + P ++ ++TPRPSRP L P K S Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTPPKCKLS 549 >01_02_0132 + 11444480-11444609,11444698-11445131,11445210-11445431, 11445510-11445971,11446053-11446885,11446968-11447138, 11447218-11447518 Length = 850 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G KT + P ++ ++TPRPSRP L P K S Sbjct: 485 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTPPKCKLS 523 >12_02_0938 - 24576419-24576719,24576817-24576969,24577052-24577884, 24577966-24578427,24578506-24579213 Length = 818 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 459 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 491 >12_02_0311 + 17361153-17361282,17361371-17362104,17362183-17362644, 17362726-17363558,17363641-17363811,17363891-17364191 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >12_02_0096 - 13573612-13573632,13573846-13573884,13574160-13574493, 13574660-13574830,13574913-13575730,13575812-13576114, 13576352-13577085,13577174-13577303 Length = 849 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 453 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 485 >12_01_0775 - 7070620-7070920,7071000-7071170,7071253-7072085, 7072167-7072628,7072707-7073440,7073529-7073658 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >12_01_0705 + 6065932-6066061,6066150-6066883,6066962-6067423, 6067505-6068337,6068420-6068590,6068670-6068919, 6069367-6069405,6069598-6069672 Length = 897 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >11_06_0576 - 25127807-25128107,25128241-25128357,25128730-25129271, 25129353-25129814,25129893-25130626,25130715-25130742 Length = 727 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 477 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 509 >11_04_0390 - 17108441-17108654,17108821-17108991,17109074-17109115, 17109364-17109905,17109987-17110448,17110527-17111260, 17111349-17111478 Length = 764 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >11_01_0582 - 4632377-4632677,4632757-4632927,4633010-4633842, 4633924-4634385,4634464-4635197,4635286-4635415 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >10_05_0091 - 9085506-9085758,9085838-9085992,9086091-9086132, 9086379-9086921,9087003-9087287,9087332-9087463, 9087542-9087729,9088186-9088240 Length = 550 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 289 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 321 >10_03_0045 - 7353148-7353448,7353528-7353698,7353781-7354613, 7354695-7355156,7355235-7355968,7356057-7356186 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_1612 + 28226138-28226267,28226356-28227089,28227168-28227629, 28227711-28228543,28228626-28228796,28228876-28229176 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_1391 + 26668539-26668668,26668757-26669490,26669569-26670030, 26670112-26670944,26671364-26671577 Length = 790 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0942 - 22845270-22845570,22845650-22845820,22845903-22846735, 22846817-22847278,22847357-22848090,22848179-22848308 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0778 + 21119812-21119941,21120030-21120463,21120576-21120695, 21121356-21121898,21121988-21122172,21122255-21122425, 21122505-21122805 Length = 627 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 297 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 329 >08_02_0712 - 20329967-20330267,20330347-20330517,20330600-20331432, 20331514-20331975,20332054-20332787,20332876-20333005 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0331 - 15852164-15852464,15852544-15852714,15852797-15853629, 15853711-15854172,15854251-15854984,15855073-15855202 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0327 + 15821587-15821716,15821805-15822538,15822617-15823078, 15823160-15823992,15824075-15824245,15824325-15824625 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_1513 - 27327702-27328604,27329957-27329995,27330413-27330692, 27330772-27330942,27331025-27331857,27331939-27332400, 27332479-27333212,27333301-27333430 Length = 1183 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0783 + 21501013-21501142,21501231-21501964,21502043-21502504, 21502586-21503418,21503501-21503671,21503751-21504051 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEYIVVKMTPRPSRPTELTP 543 >07_03_0729 - 21025525-21025825,21025905-21026075,21026158-21026990, 21027072-21027533,21027612-21028345,21028434-21028563 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0422 + 18015230-18015359,18015448-18016181,18016260-18016721, 18016803-18017635,18017718-18017888,18017968-18018268 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0139 + 14143383-14143512,14143601-14144334,14144413-14144874, 14144956-14145788,14145871-14146041,14146121-14146379, 14146828-14146866,14147903-14147989 Length = 904 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0052 - 12833004-12833057,12833917-12833955,12834231-12834651, 12834731-12834901,12834984-12835816,12835898-12836359, 12836438-12837171,12837260-12837389 Length = 947 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_01_0943 - 7959813-7960113,7960193-7960363,7960446-7961278, 7961360-7961821,7961899-7962606 Length = 824 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 459 TLGDTRKTFIQWPKEDIVVKMTPRPSRPTELTP 491 >07_01_0811 - 6377328-6377628,6377708-6377878,6377961-6378145, 6378255-6378797,6378879-6379304,6379383-6380116, 6380205-6380334 Length = 829 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 499 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 531 >06_03_0463 - 21038166-21038466,21038546-21038716,21038799-21039631, 21039713-21040174,21040253-21040986,21041075-21041204 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >06_03_0249 + 18700299-18700769,18700848-18701309,18701391-18702223, 18702306-18702476,18702556-18702856 Length = 745 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 380 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 412 >06_01_1107 + 9120664-9120793,9120882-9121615,9121694-9123069, 9123152-9123322,9123402-9123702 Length = 903 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 538 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 570 >05_07_0085 - 27591909-27592152,27592232-27592402,27592485-27592648, 27592775-27593317,27593399-27593860,27593939-27594672, 27594761-27594890 Length = 815 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >05_03_0464 + 14350391-14350520,14350609-14351342,14351421-14351882, 14351964-14352796,14352879-14352948,14352964-14353049, 14353129-14353429 Length = 871 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >05_03_0399 + 13517874-13518003,13518092-13518825,13518904-13519365, 13519447-13520279,13520362-13520532,13520612-13520912 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >04_04_0899 - 29229812-29229929,29230009-29230179,29230262-29231094, 29231176-29231637,29231716-29232186 Length = 684 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 380 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 412 >04_04_0067 + 22498987-22499116,22499205-22499938,22500017-22500478, 22500560-22501392,22501475-22501645,22501725-22502025 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >04_03_0574 - 17338777-17339077,17339390-17340222,17340304-17340765, 17340843-17341030,17341244-17341576,17341665-17341796, 17342604-17342643 Length = 762 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 454 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 486 >04_03_0262 + 13597021-13597150,13597239-13597972,13598051-13598512, 13598594-13599136,13599385-13599426,13599594-13599679, 13599759-13600017,13600456-13600494,13603624-13603737 Length = 802 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >04_02_0023 + 8655524-8655653,8655742-8656475,8656553-8656918, 8657062-8657183,8657210-8657786 Length = 642 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 470 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 502 >04_01_0606 - 7949609-7949822,7949989-7950159,7950242-7951074, 7951156-7951476,7951696-7952166 Length = 669 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 333 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 365 >04_01_0224 - 2830669-2830969,2831049-2831219,2831302-2832134, 2832216-2832677,2832756-2833489,2833578-2833707 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >04_01_0118 - 1223530-1223830,1223910-1224080,1224163-1224995, 1225077-1225538,1225617-1226350,1226439-1226568 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >04_01_0048 + 522423-522552,522641-523374,523453-524828,528100-528400 Length = 846 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 538 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 570 >03_06_0623 + 35160081-35160210,35160299-35161032,35161111-35161572, 35161654-35162486,35162569-35162739,35162819-35163119 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >02_03_0337 + 17898732-17899370,17899516-17899977,17900058-17900688, 17900819-17900888,17900971-17901141,17901221-17901479, 17901918-17901956,17902900-17902914 Length = 761 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 436 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 468 >02_01_0601 + 4465775-4465924,4466070-4466531,4466613-4467445, 4467528-4467597,4467613-4467698,4467865-4468036, 4468481-4468519,4469410-4469430 Length = 610 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 273 TLGDAHKTFIQWPKEDIVVKMTPRPSRPTELTP 305 >01_03_0195 - 13674138-13674438,13674518-13674688,13674771-13675603, 13675685-13676146,13676225-13676958,13677047-13677176 Length = 876 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >12_01_0801 + 7351171-7351198,7351383-7352020,7352098-7352559, 7352641-7353105 Length = 530 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPSRP L P Sbjct: 445 TLGDARKTFIQWPKEDIVVKMTPRPSRPTELIP 477 >08_01_0258 - 2112170-2112470,2112550-2112720,2112803-2113635, 2113717-2114178,2114257-2114990,2115079-2115208 Length = 876 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T G KT + P ++ ++TPRPSRP L P Sbjct: 511 TFGDARKTFIQWPKEDIVVKMTPRPSRPTELTP 543 >07_01_1087 - 9959933-9960212,9960292-9960462,9960545-9961365, 9961985-9962455 Length = 580 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G KT + P ++ ++TPRPSRP P K S Sbjct: 226 TLGDARKTFIQWPKEDIVVKMTPRPSRPTEFTPPKFKLS 264 >11_08_0016 + 27652728-27653011,27653105-27653198,27653277-27653738, 27653819-27654651,27654734-27654886,27654984-27655242, 27655653-27655691,27655708-27655791 Length = 735 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRP+RP L P Sbjct: 349 TLGDARKTFIQWPKEDIVVKMTPRPNRPTELTP 381 >06_03_1348 - 29497084-29497384,29497464-29497634,29497717-29498549, 29498631-29499092,29499171-29499904,29499993-29500122 Length = 876 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G KT + P ++ ++TP PSRP L P K S Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPHPSRPTELTPPKCKLS 549 >01_06_1389 - 36969414-36969436,36970027-36970394,36970474-36970644, 36970727-36971559,36971642-36972103,36972182-36972915, 36973004-36973133 Length = 906 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TPRPS+P L P Sbjct: 511 TLGDARKTFIQWPKEDIVVKMTPRPSQPTELTP 543 >12_02_0969 - 24936399-24936699,24936779-24936949,24937032-24937852, 24937946-24938407,24938486-24938890 Length = 719 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEPSCLKNS 4 T+G K + P ++ ++TPRPSRP PS K S Sbjct: 354 TLGDARKMFIQWPKEDIVVKMTPRPSRPTEFTPSKSKLS 392 >10_08_0786 - 20540061-20542106 Length = 681 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 253 RVVKQFMEMYKMGMLPRGETFVHTNELQMEEAVKVFRVLYYAK 381 +V K +EM KMG +PR E H +EE VK ++ Y+++ Sbjct: 577 KVAKLDLEMRKMGYIPRTEFVYH----DLEEEVKEQQLSYHSE 615 >03_04_0008 - 16274158-16274458,16274791-16275623,16275706-16276167, 16276245-16276882,16277068-16277197 Length = 787 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + P ++ ++TP PSRP L P Sbjct: 479 TLGDARKTFIQWPKEDIVVKMTPHPSRPTELTP 511 >02_04_0153 - 20330775-20330831,20330913-20330999,20333119-20333157, 20333596-20333754,20334035-20334104,20334187-20335035, 20335270-20335562,20335640-20336347 Length = 753 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G T + P ++ ++TPRPSRP L P Sbjct: 408 TLGDARNTFIQWPKEDIVVKMTPRPSRPTELTP 440 >07_01_0431 + 3283252-3283274,3283684-3283819,3285839-3286682, 3286785-3286856,3286906-3286937,3287020-3287433 Length = 506 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = -1 Query: 692 VLGIKKPAXSLTPVNHYQIVVSNRDAVVFPEDRVLGGFSHLHHKGFTDDMAVNEEVGIDL 513 +L +K+ A + NH++ + +R+++VF VL H+ +D +N+E+ I+ Sbjct: 62 LLPLKEAARTSVLSNHWKNIWCSRESLVFRFYTVLSMHHHIKRCWTSDGQRLNKELFIER 121 Query: 512 V 510 V Sbjct: 122 V 122 >01_03_0214 + 13863123-13863593,13863671-13864132,13864308-13865038, 13865121-13865291,13865371-13865629,13866069-13866158 Length = 727 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+ KT + P ++ ++TPRPSRP L P Sbjct: 348 TLSDARKTFIQWPKEDIVVKMTPRPSRPTELTP 380 >06_02_0289 + 13825103-13825510,13825651-13826112,13826189-13827021, 13827104-13827274,13828025-13828076 Length = 641 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 114 TIGSLVKTIVP*PP--LIAELTPRPSRPVVLEP 22 T+G KT + +I ++TPRPSRP L P Sbjct: 359 TLGDARKTFIQWSKEDIIVKMTPRPSRPTELTP 391 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,214,366 Number of Sequences: 37544 Number of extensions: 433832 Number of successful extensions: 1231 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1231 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -