BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0742 (783 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 26 0.30 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.8 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 4.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 4.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 4.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.8 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 26.2 bits (55), Expect = 0.30 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 485 CTHQNRTLYSLHSDVESAPPSPHHTKVDDM 574 C + +T+ SL + E PP P ++D+M Sbjct: 79 CEIKEKTVLSLRNTQEEEPPDPQLMRLDNM 108 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = -2 Query: 218 CPFAERNCTVRNVP-NYLANK 159 CP +R CTV NV + L NK Sbjct: 12 CPVKKRKCTVSNVSLHSLKNK 32 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 2.8 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = -2 Query: 731 NGVXRXSXKGXRKLVGDSVSDLAPTSLPGAAIHXTVADYSRRWPASLGSIRLPY 570 NG S ++ DSVS P P V +WP+ +G+ LPY Sbjct: 239 NGPLDLSVSSRKRSNDDSVSQ-PPNRKPRTDFKPQVLP---QWPSPIGASHLPY 288 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 18 PGHGLQPTMGDYTQLQPQRLASTHL 42 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 650 PGAAIHXTVADYSRRWPASLGSIRL 576 PG + T+ DY++ P L S L Sbjct: 62 PGHGLQPTMGDYTQLQPQRLASTHL 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,815 Number of Sequences: 336 Number of extensions: 3812 Number of successful extensions: 18 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -