BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0742 (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|c... 27 3.0 SPCPJ732.03 |meu15||sequence orphan|Schizosaccharomyces pombe|ch... 26 5.3 SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ... 25 9.3 SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain p... 25 9.3 >SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 354 ADIDPEMHDILDEDERSDWLIE 419 A IDPE + DER DWL E Sbjct: 54 ATIDPEEAKVAVPDERFDWLCE 75 >SPCPJ732.03 |meu15||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 150 Score = 26.2 bits (55), Expect = 5.3 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 112 HYRCPF--VVAIKMCFYEVCPNARNVWCARIRESY 14 HY P+ + I+M +YE+ WC ++R + Sbjct: 65 HYEVPYKWIFIIEMLYYELYLTLYVCWCYKLRSDF 99 >SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 932 Score = 25.4 bits (53), Expect = 9.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 263 KKLLEKNSHNTTVTGCPFAERNCTVRNVPNYLAN 162 ++ + +NS+N + G N TV N+P+Y N Sbjct: 382 RRNVSRNSNNNSPEGYDNNRTNPTVNNLPSYPTN 415 >SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 607 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 339 KDVWEADIDPEMHDILDEDERSDWLIERDSKS 434 K +AD +PE + LDE + +D DSKS Sbjct: 309 KTTEDADEEPETEENLDEFKPADGADNEDSKS 340 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,172,065 Number of Sequences: 5004 Number of extensions: 64356 Number of successful extensions: 151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -