BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0739 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 25 2.4 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 5.4 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 7.2 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 7.2 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 7.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 7.2 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 7.2 AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. 23 9.5 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/60 (21%), Positives = 25/60 (41%) Frame = -3 Query: 694 VVQPSWRKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRPPVIIHKFPDSNLMKSIIFVV 515 VVQ + +C + + GC++ + L P HK+ L++ IF++ Sbjct: 124 VVQANIHNLCVLRVIWRVFGISSGCVAFVMALERYIALAKPFFYHKYVTDKLIRKSIFIL 183 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 43 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 189 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 685 PSWRKVCPVESLMCTMSKEPGCLSRDTMV 599 P +K C E++ C S PGC+ + V Sbjct: 37 PCPQKACISEAVKCQTSCLPGCVCKKGFV 65 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 43 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 189 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 43 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 189 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 465 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 376 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 7.2 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -1 Query: 222 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 43 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 >AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. Length = 103 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 698 TRCSTLVAKGVSRGVLDVHNVEGAGMSLAGHDGAHTPQ 585 TRC +L VSR D + + A S+ G +T + Sbjct: 60 TRCGSLCGSPVSRAQTDDDDDDAAAASVMWCKGTNTEE 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 855,753 Number of Sequences: 2352 Number of extensions: 19587 Number of successful extensions: 93 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -