BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0738 (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01520.1 68414.m00068 myb family transcription factor similar... 33 0.28 At4g22110.2 68417.m03197 alcohol dehydrogenase, putative similar... 30 2.0 At4g22110.1 68417.m03196 alcohol dehydrogenase, putative similar... 30 2.0 At1g51160.1 68414.m05752 synbindin, putative similar to Swiss-Pr... 29 2.6 At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein ... 29 3.4 At1g52380.1 68414.m05911 Ran-binding protein 1 domain-containing... 29 4.5 At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protei... 28 6.0 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 7.9 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 7.9 >At1g01520.1 68414.m00068 myb family transcription factor similar to myb-related protein GI:2505876 from [Arabidopsis thaliana] Length = 287 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 212 CDASVVAAVQSRTSGVCLNVCDDTVS-GTRRTRLVTRTKESSXC 340 CD S+ ++V GV N C + S +RTR+VT T + C Sbjct: 172 CDVSIPSSVIKEEFGVSENCCSTSSSRDKQRTRIVTETNDQESC 215 >At4g22110.2 68417.m03197 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 389 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/68 (32%), Positives = 32/68 (47%) Frame = +2 Query: 128 LKKIFSYASGPTQVNVVFSRFLP*CGRECDASVVAAVQSRTSGVCLNVCDDTVSGTRRTR 307 ++ I + +G Q +VV F P C EC +S S C DD +S TRR Sbjct: 83 IESIGEHVNGFQQGDVVLPVFHPHC-EEC-----RDCKSSKSNWCARFADDFLSNTRRYG 136 Query: 308 LVTRTKES 331 + +R K+S Sbjct: 137 MTSRFKDS 144 >At4g22110.1 68417.m03196 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 389 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/68 (32%), Positives = 32/68 (47%) Frame = +2 Query: 128 LKKIFSYASGPTQVNVVFSRFLP*CGRECDASVVAAVQSRTSGVCLNVCDDTVSGTRRTR 307 ++ I + +G Q +VV F P C EC +S S C DD +S TRR Sbjct: 83 IESIGEHVNGFQQGDVVLPVFHPHC-EEC-----RDCKSSKSNWCARFADDFLSNTRRYG 136 Query: 308 LVTRTKES 331 + +R K+S Sbjct: 137 MTSRFKDS 144 >At1g51160.1 68414.m05752 synbindin, putative similar to Swiss-Prot:Q9ES56 synbindin (TRS23 homolog) [Mus musculus] Length = 169 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 1 GLRRSRGRPYEFYSFRTRSDRVSFRSTHSDGIIKLITH 114 G+ + G+ F+SFRT + ++SF T S I L+TH Sbjct: 82 GVPQLPGQGCSFHSFRTNTYKLSFMETPSGIKIILVTH 119 >At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 437 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -2 Query: 310 KTGPASARNCIIADVQTNTTSPRLHGCDNRRVALASALRQETRKYDVDLR-RAGR 149 KTG S NC A P RR + S LR D DLR R GR Sbjct: 17 KTGDCSRPNCTFAHGNAELRRPGESSFTGRRHNMDSDLRDRRHNMDSDLRDRLGR 71 >At1g52380.1 68414.m05911 Ran-binding protein 1 domain-containing protein / RanBP1 domain-containing protein weak similarity to SP|Q09717 Ran-specific GTPase-activating protein 1 (Ran binding protein 1) (RANBP1) (Spi1-binding protein) {Schizosaccharomyces pombe}; contains Pfam profile PF00638: RanBP1 domain Length = 440 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 200 CGRECDASVVAAVQSRTSGVCLNVCDDTVSGTRRT 304 CG+ D V A ++ NVC++ V GT +T Sbjct: 148 CGKSADVQVAATEVAQMVSCDTNVCNNAVEGTDQT 182 >At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protein similar to SP|Q05022 rRNA biogenesis protein RRP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00575: S1 RNA binding domain Length = 1838 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +2 Query: 203 GRECDASVVAAVQSRTSGVCLNVCDDTVSGTRRTRLVTRTKESSXC 340 G+ ASV A TSG L + D +VSGT T R K+ S C Sbjct: 923 GQSVVASVKAVQNPLTSGRLLLLLD-SVSGTSETSRSKRAKKKSSC 967 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/59 (38%), Positives = 29/59 (49%) Frame = -2 Query: 622 SSDESICTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCQSAPSFTDWKRDASGVRKSRT 446 SSD+S S S R S+ SP + SSPS S S D KR +S RK+R+ Sbjct: 825 SSDDSKRKSRSRRRSVSPSPVRSRRKRSSPS--------SDESSDDSKRKSSSKRKNRS 875 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/59 (38%), Positives = 29/59 (49%) Frame = -2 Query: 622 SSDESICTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCQSAPSFTDWKRDASGVRKSRT 446 SSD+S S S R S+ SP + SSPS S S D KR +S RK+R+ Sbjct: 795 SSDDSKRKSRSRRRSVSPSPVRSRRKRSSPS--------SDESSDDSKRKSSSKRKNRS 845 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,634,679 Number of Sequences: 28952 Number of extensions: 313941 Number of successful extensions: 723 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -