BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0737 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 27 0.81 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 25 3.3 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 10.0 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 26.6 bits (56), Expect = 0.81 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 462 TGQHXLPVPNPTRPGPQSQS 403 TG LP P+ PGPQ+Q+ Sbjct: 312 TGVPPLPADGPSNPGPQTQT 331 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 24.6 bits (51), Expect = 3.3 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = -3 Query: 489 NARTSTRPGTGQHXLPVPNPTRPGPQSQSLFRSYGSNLPTSLTYIILSTRGSSPW--RPA 316 N TSTRPG + + + + + Q+ ++ LT I +++ P RP+ Sbjct: 410 NRPTSTRPGNNLNDVLIFSRFQNETMEQTTVVPEAADTTEPLT-IETTSQSFVPLTNRPS 468 Query: 315 ADMGTNRRDISTYIP 271 +G +RD+S +P Sbjct: 469 GRVGRTKRDVSYKVP 483 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 10.0 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 669 AHSVTTAVQRVSSELAXTKGNPTV 740 AHS+ + V + +E+ T G P++ Sbjct: 360 AHSLASGVAHLHTEIFGTPGKPSI 383 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 811,028 Number of Sequences: 2352 Number of extensions: 16643 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -