BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0733 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 29 0.55 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 28 1.3 SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|S... 26 5.1 SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosa... 26 5.1 SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,... 26 6.7 SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyce... 25 8.9 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 29.5 bits (63), Expect = 0.55 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = +3 Query: 585 GFTSSLFSCASTFTTSWFNHP--FLPATAGFGRLDFLTLASSVLAGLWQNCWQPSGGSGG 758 G S L S T + ++ P P AG G L LAS L L+ + GG GG Sbjct: 133 GLFSGLTSSNGYTTGNSYSRPSYVAPVAAGLGGLALGGLASHALGNLFHHRGHNGGGFGG 192 Query: 759 F 761 F Sbjct: 193 F 193 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 28.3 bits (60), Expect = 1.3 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 757 PPDPPDGCQQFCHKPANTEEANVRKSSRPNPAVAGR-KG*LNQEVVKVEAQEKSE 596 PP PP G + P V+K PA +G + LN+ K A +KS+ Sbjct: 11 PPPPPPGFEPPSQPPPPPPPGYVKKRKNKTPAQSGNLEKQLNERARKWRASQKSK 65 >SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 26.2 bits (55), Expect = 5.1 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -3 Query: 652 RKG*LNQEVVKVEAQEKSEEVKPRRCKRIRHSESGRNTTICGRHTTRRNKST 497 R G + + KVE QEK ++ K R KR+ + N T R N S+ Sbjct: 10 RAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS 61 >SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 1|||Manual Length = 61 Score = 26.2 bits (55), Expect = 5.1 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -3 Query: 652 RKG*LNQEVVKVEAQEKSEEVKPRRCKRIRHSESGRNTTICGRHTTRRNKST 497 R G + + KVE QEK ++ K R KR+ + N T R N S+ Sbjct: 10 RAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS 61 >SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 546 Score = 25.8 bits (54), Expect = 6.7 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 588 FTSSLFSCASTFTTSWFNHPFLPATAGFGRLDFLTLAS 701 F SLF ++ SWF +P L A G L + ++ S Sbjct: 67 FIPSLFIAVLSYIPSWFVNPLLAARWTIGYLSWESMNS 104 >SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 494 SSRFVSSGRVSAADGCVSAGFT 559 S +F+S+ +AA+G VSA FT Sbjct: 335 SPKFISARAAAAAEGVVSAPFT 356 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,789,292 Number of Sequences: 5004 Number of extensions: 50425 Number of successful extensions: 157 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -