BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0733 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 25 1.9 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 25 3.4 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 3.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.8 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 25.4 bits (53), Expect = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 757 PPDPPDGCQQFCHKPAN 707 PPDP Q CH P N Sbjct: 336 PPDPETTSSQQCHPPVN 352 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 759 THRTHQTAASSSATNRPTPKRLMLENPAGRI 667 T +++ +A +AT P PKR + AG++ Sbjct: 42 TPESNRQSAQWTATGEPAPKRGKTQKSAGKV 72 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 578 MQTHPAQ*IRQKHNHLRPTHDPK 510 +Q HPA+ +Q++N R H P+ Sbjct: 332 VQAHPARSFKQQNNEARAHHLPR 354 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 687 LTLASSVLAGLWQNCW 734 L+L+ V LW++CW Sbjct: 515 LSLSLGVFPALWKSCW 530 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,124 Number of Sequences: 2352 Number of extensions: 13258 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -