BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0729 (806 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006615-4|AAK68233.2| 602|Caenorhabditis elegans Hypothetical ... 29 3.9 U50068-2|AAD47116.3| 426|Caenorhabditis elegans Hypothetical pr... 28 9.0 >AC006615-4|AAK68233.2| 602|Caenorhabditis elegans Hypothetical protein C36B7.6 protein. Length = 602 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 599 PALYFISEWIISIGYIPTHATQKVWRLSLSXWIFSHYSY 715 P L+F + W + Y+P + T K +LS++ + S + Y Sbjct: 251 PILFFNNYWNLGADYMPINETVKELKLSVTFYPLSIFKY 289 >U50068-2|AAD47116.3| 426|Caenorhabditis elegans Hypothetical protein C01G5.9 protein. Length = 426 Score = 27.9 bits (59), Expect = 9.0 Identities = 22/94 (23%), Positives = 37/94 (39%) Frame = +1 Query: 130 NFVHNDSLLQKRTTGSEHRCIATYECTMSYPLGHDYFKTTTWSPRGWVPPPCLFLP*SSN 309 +F N S L+ G+E +C+ + C L F+T +S WV L Sbjct: 224 DFYRNSSNLEVIQMGNETKCLNRHRCRHEMQLQDCVFRTQKYS--SWVATVDL----DER 277 Query: 310 AFRLEGWGSRCNYT*DLRTCISRWVAHLRCGCLW 411 ++ + +Y +R C ++ LR C W Sbjct: 278 IMMIDEKSTLLDY---IRNCNDHKISELRFRCQW 308 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,162,903 Number of Sequences: 27780 Number of extensions: 420100 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1977346024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -