BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0727 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 5.7 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 7.6 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 442 ESCTCSPKNCERKESNI*TKEQTNGS 519 E C+C P+ E+ E I + NG+ Sbjct: 883 EECSCYPRGTEQTEKGISICDAINGN 908 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.4 bits (48), Expect = 7.6 Identities = 17/64 (26%), Positives = 32/64 (50%) Frame = +3 Query: 309 QPKRKEEDEYQYTACKAFKQLLQELGDFAGQREVVAENLQSNVVRELHLLAKELREERKQ 488 QP+++++ +Y + +QL Q+ QR VVA + Q ++ H ++ R+ K Sbjct: 328 QPQQQQQQTGRYQPPQMRQQLQQQQQQRQPQRYVVAGSSQQQ--QQQHQQQQQKRKRPKP 385 Query: 489 HLNE 500 L E Sbjct: 386 ELIE 389 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 725,796 Number of Sequences: 2352 Number of extensions: 14533 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -