BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0725 (863 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_40684| Best HMM Match : NIF (HMM E-Value=0) 30 2.8 SB_8644| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 8.5 SB_11363| Best HMM Match : Transposase_11 (HMM E-Value=2.3e-39) 28 8.5 >SB_24569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1660 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +2 Query: 698 MLCPNFHGRTFDL*XPTCNXLPMNLSVLDDRXNAYGIKQRSVXGEIHDVRPTSN 859 +LCPN G FD+ CN P+ + +D + + QR + D P SN Sbjct: 102 VLCPNDVG--FDVTNSKCNDCPIGTTAVDRLIDGTKLSQRQCLKCVSDTSPVSN 153 >SB_40684| Best HMM Match : NIF (HMM E-Value=0) Length = 402 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +1 Query: 292 MLPRGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACWMR---ERINGGMFVYAFTA 462 +L ET VH + ++E+A F V Y + VF+RT ++ ER++ V FTA Sbjct: 220 VLDLDETLVHCSLNKLEDATLSFPVSYQDITYQVFVRTRPHLKYFLERVSKVFEVILFTA 279 Query: 463 A 465 + Sbjct: 280 S 280 >SB_8644| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 1011 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 403 TACWMRERINGGMFVYAFTAACFHR 477 TAC+ + I+GG+ V+++ + FHR Sbjct: 836 TACFWGQLISGGITVFSYRISSFHR 860 >SB_11363| Best HMM Match : Transposase_11 (HMM E-Value=2.3e-39) Length = 402 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 451 AFTAACFHRTDCKGLYLPALTRSIPTSSLT 540 + T AC DCK L L L R++PT + T Sbjct: 25 SLTLACHALLDCKTLTLTELGRNLPTKART 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,299,879 Number of Sequences: 59808 Number of extensions: 528705 Number of successful extensions: 1089 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -