BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0720 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36229| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 32 0.47 SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 >SB_36229| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 269 Score = 31.9 bits (69), Expect = 0.47 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 254 RRQEAESGGSVFSEDKRGRLFGNG--QXRPLNAAT 352 R+Q ++ GG +F ED+ LFG+G Q +P N T Sbjct: 40 RKQTSQGGGGLFDEDEDEGLFGSGASQKKPSNDVT 74 >SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 31.9 bits (69), Expect = 0.47 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 254 RRQEAESGGSVFSEDKRGRLFGNG--QXRPLNAAT 352 R+Q ++ GG +F ED+ LFG+G Q +P N T Sbjct: 929 RKQTSQGGGGLFDEDEDEGLFGSGASQKKPSNDVT 963 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,114,946 Number of Sequences: 59808 Number of extensions: 387473 Number of successful extensions: 736 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -