BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0720 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 27 0.52 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 1.6 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 27.1 bits (57), Expect = 0.52 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +3 Query: 147 PGRLQAVAAQPSSRQSQPTVFKAVGSQPYSRQSQTFAVRRRSQEAACSAKTNV 305 PGR A A PSS + P+ +V S P SR S S ++A N+ Sbjct: 57 PGRTYASALSPSSSSASPSSPSSVAS-PNSRASNMSPESSASDQSAAYTLQNL 108 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.4 bits (53), Expect = 1.6 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -1 Query: 546 PEAPLPXACLRTPCLFWVTA*RKPRIPHFSMGVHLLELNNGIVHLPNV*PEPLP 385 P P A L P F R P F + L G +LPN P P P Sbjct: 532 PPPPPGGAVLNIPPQFLPPPLNLLRAPFFPLNPAQLRFPAGFPNLPNAQPPPAP 585 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,729 Number of Sequences: 2352 Number of extensions: 12322 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -