BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0720 (657 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006661-7|AAF39888.2| 1427|Caenorhabditis elegans Hypothetical ... 28 5.1 L46861-1|AAA74747.1| 2553|Caenorhabditis elegans talin protein. 27 8.9 AC025726-17|AAK73909.2| 2553|Caenorhabditis elegans Hypothetical... 27 8.9 >AC006661-7|AAF39888.2| 1427|Caenorhabditis elegans Hypothetical protein H20J04.2 protein. Length = 1427 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 331 EAVERGNVTHSSGCHVFTWQRFRLNIRQMNDSVVKFKKMNTH*KVWD 471 EA ER + + + T+ +FR ++ Q + +V+ K+ K WD Sbjct: 660 EAPERLEIVKTLIYQLLTYSKFRGHLEQRQNELVELKREQKKLKAWD 706 >L46861-1|AAA74747.1| 2553|Caenorhabditis elegans talin protein. Length = 2553 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 382 TWQRFRLNIRQMNDSVVK 435 TWQR +N RQ++DS+++ Sbjct: 1642 TWQRMAVNSRQVSDSIMR 1659 >AC025726-17|AAK73909.2| 2553|Caenorhabditis elegans Hypothetical protein Y71G12B.11a protein. Length = 2553 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 382 TWQRFRLNIRQMNDSVVK 435 TWQR +N RQ++DS+++ Sbjct: 1642 TWQRMAVNSRQVSDSIMR 1659 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,931,634 Number of Sequences: 27780 Number of extensions: 278453 Number of successful extensions: 758 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -