BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0720 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 4.5 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.9 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +3 Query: 138 SRSPGRLQAVAAQPSSRQSQPTVFKAVGSQPYSRQSQTFAVRRRSQ 275 S PG ++ V+ S ++QPT+ + + + AVR SQ Sbjct: 712 SHQPGAMEQVSYLTSLERTQPTMSQMPPTAQPRMERLAEAVRTASQ 757 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 313 IRKRPXEAVERGNVTHSSGCHVFTWQRFRLNI 408 + KR +A++ GNV G + +Q +NI Sbjct: 346 LEKRLRDAIDSGNVITPQGVFLSLYQPQGMNI 377 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -1 Query: 345 AFNGLXWPFPNNLPRLSSLNTLPPDSAS*RRTSATALNT 229 AF+ P P NL ++ S PP S++ + T T Sbjct: 74 AFSSSCDPVPGNLEQIGSRPLHPPASSTSLPATITTTTT 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,437 Number of Sequences: 438 Number of extensions: 3689 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -