BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0720 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29510.1 68415.m03584 expressed protein 28 4.8 At3g23070.1 68416.m02908 expressed protein contains Pfam domain,... 27 8.3 >At2g29510.1 68415.m03584 expressed protein Length = 839 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 590 STSISLWTQESKPRCQKPLCRQPVSER 510 STS SLWT ES + LC P ++ Sbjct: 139 STSSSLWTDESSTDSSRGLCASPFRKK 165 >At3g23070.1 68416.m02908 expressed protein contains Pfam domain, PF04581: Protein of unknown function (DUF578) Length = 881 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 200 NRIQGSRQPTVFKAVADVRRQEAESGGSVFSEDKRGRLFGNG 325 NRIQ QP K V + R++ SG + S D G+G Sbjct: 75 NRIQKRNQPKPPKVVVNYRKEGRFSGSEIVSGDDNRSRDGDG 116 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,450,398 Number of Sequences: 28952 Number of extensions: 267145 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -