BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0716 (595 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 43 2e-06 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 36 3e-04 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 3.4 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 5.9 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 43.2 bits (97), Expect = 2e-06 Identities = 25/77 (32%), Positives = 35/77 (45%) Frame = +2 Query: 299 LPRGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERXNGGMFVYAFTAACFH 478 L R E F + A K+ R+ A+ D + A + R+R N +F YAF+ A H Sbjct: 74 LGRHENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLH 133 Query: 479 RTDCKGLYLPLLTRSIP 529 R D + L LP P Sbjct: 134 RPDTQNLDLPSFIHVFP 150 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 35.5 bits (78), Expect = 3e-04 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +2 Query: 383 KDFDVFMRTACWMRERXNGGMFVYAFTAACFHRTDCKGLYLPLLTRSIP 529 ++ D + A + R+R N +F YA + A HR D + + LP S P Sbjct: 102 RNVDDLLSVAVYARDRVNPYLFSYALSVAILHRQDTQDIDLPSFIESFP 150 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 585 FSHLHHKGFTDDMAVNEE 532 F+HL H+ FT + VN + Sbjct: 474 FTHLQHQPFTYKITVNNQ 491 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 451 DEHASVXPFSHPARSPHENIEVLSVVEDSEDFDGFF 344 D ++ P + P R P +N + L +E S + G F Sbjct: 125 DMETTLTPCASPNRKPDDNQDHLRRLEMSLEKSGLF 160 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 126 DMKMKELCIMKLLDHI 173 D K+ LC+ L+DH+ Sbjct: 442 DEKLNALCMTWLMDHV 457 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,479 Number of Sequences: 336 Number of extensions: 2436 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -