BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0712 (838 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006644-6|AAZ91358.1| 958|Caenorhabditis elegans Hypothetical ... 29 3.1 Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 4.1 AL132949-27|CAB61105.1| 209|Caenorhabditis elegans Hypothetical... 29 4.1 Z80217-2|CAB02288.1| 209|Caenorhabditis elegans Hypothetical pr... 28 9.5 Z75541-6|CAA99857.2| 644|Caenorhabditis elegans Hypothetical pr... 28 9.5 AF440800-1|AAL28139.1| 644|Caenorhabditis elegans transcription... 28 9.5 >AC006644-6|AAZ91358.1| 958|Caenorhabditis elegans Hypothetical protein F55A3.1 protein. Length = 958 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 298 LVGVDEGLSTREHAHLYISMNCLTTSTFMY 209 L+G+D L EH IS+N L T+TF Y Sbjct: 406 LLGLDGSLIFLEHVFWVISLNTLFTATFAY 435 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 376 RSPHENIEVLSVVEDSEDFD 317 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >AL132949-27|CAB61105.1| 209|Caenorhabditis elegans Hypothetical protein Y53F4B.31 protein. Length = 209 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = -1 Query: 472 GQVETLAVGSVEARGSKSVDEHAXVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLELV 293 GQV L V + S ++ + + F + ++P E + ++V+ +DF G F ++ Sbjct: 51 GQVPYLTVDGFDIPQSAAIIRYL-ANKFGYAGKTPEEQVWADAIVDQFKDFMGSFRERIM 109 Query: 292 GVDEGLSTREHAHL 251 G S E A + Sbjct: 110 AHFAGKSQEEIAKI 123 >Z80217-2|CAB02288.1| 209|Caenorhabditis elegans Hypothetical protein F37B1.2 protein. Length = 209 Score = 27.9 bits (59), Expect = 9.5 Identities = 19/70 (27%), Positives = 30/70 (42%) Frame = -1 Query: 472 GQVETLAVGSVEARGSKSVDEHAXVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLELV 293 GQ+ L V E S ++ + F ++P E V +VV+ +DF G F ++ Sbjct: 51 GQMPVLNVDGFEIPQSAAITRYL-ARKFGFAGKTPEEEAWVDAVVDQFKDFFGEFRKLII 109 Query: 292 GVDEGLSTRE 263 G S E Sbjct: 110 AQRAGKSVEE 119 >Z75541-6|CAA99857.2| 644|Caenorhabditis elegans Hypothetical protein F52B5.5a protein. Length = 644 Score = 27.9 bits (59), Expect = 9.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 171 IAKEYNIEKSCDKYMNVDVVKQ 236 + + N+ + C+K+M +DV+KQ Sbjct: 212 VQSDMNLNEDCEKWMEIDVLKQ 233 >AF440800-1|AAL28139.1| 644|Caenorhabditis elegans transcription factor CEP-1 protein. Length = 644 Score = 27.9 bits (59), Expect = 9.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 171 IAKEYNIEKSCDKYMNVDVVKQ 236 + + N+ + C+K+M +DV+KQ Sbjct: 212 VQSDMNLNEDCEKWMEIDVLKQ 233 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,535,239 Number of Sequences: 27780 Number of extensions: 307895 Number of successful extensions: 657 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2066533546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -