BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0712 (838 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 29 3.8 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 29 3.8 At3g14970.1 68416.m01893 zinc finger (C3HC4-type RING finger) fa... 28 6.7 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 28 8.8 At1g60740.1 68414.m06838 peroxiredoxin type 2, putative strong s... 28 8.8 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 275 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 400 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 275 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 400 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At3g14970.1 68416.m01893 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 220 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +3 Query: 54 TMVFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIEKSCDKYMNVDVVK 233 T F K + + D + ++ + +LD I P + + E+ K CDK NV V Sbjct: 66 THEFDKGLLFSGDREQIQVIVCHILDLIKAPRYIDVVTELIDAILDLKKCDKISNVKEVD 125 Query: 234 QFMEMYKW 257 + + W Sbjct: 126 VVINVIVW 133 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 472 GQVETLAVGSVEAR--GSKSVDEHAXVDPFSHPARSPHENIEV 350 G+ ET++ G V+A GS V+E DP S P ++P E + + Sbjct: 2332 GRRETMSSGEVKAEEIGSDGVNEST--DPSSLPGQTPQERVRL 2372 >At1g60740.1 68414.m06838 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 27.9 bits (59), Expect = 8.8 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 5/81 (6%) Frame = -1 Query: 451 VGSVEARGSKSVDE---HAXVDPFSHPA--RSPHENIEVLSVVEDSEDFDGFFHLELVGV 287 +G E SK +DE + DPF A ++ EN V V + S ++ LEL Sbjct: 60 IGKAEELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLK 119 Query: 286 DEGLSTREHAHLYISMNCLTT 224 D+GL R + N T Sbjct: 120 DKGLGIRSRRFALLLDNLKVT 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,948,794 Number of Sequences: 28952 Number of extensions: 297438 Number of successful extensions: 745 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -