BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0709 (305 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.07 |ubp10||ubiquitin C-terminal hydrolase Ubp10|Schizosa... 26 1.4 SPAC3G9.06 |frs2||phenylalanine-tRNA ligase alpha subunit Frs2 |... 26 1.4 SPBC947.13 |rba50||RNA polymerase II associated protein |Schizos... 25 2.5 >SPBC577.07 |ubp10||ubiquitin C-terminal hydrolase Ubp10|Schizosaccharomyces pombe|chr 2|||Manual Length = 502 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 75 NNLTGRDLEEFNRIHFGRRNNLEI 146 NN+ R +EE N I G+R LE+ Sbjct: 8 NNILKRHIEEDNNIDNGKRKKLEL 31 >SPAC3G9.06 |frs2||phenylalanine-tRNA ligase alpha subunit Frs2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 499 Score = 25.8 bits (54), Expect = 1.4 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 45 ETHSLESII-NNNLTGRDLEEFNRIHFGRRNNLEIKLK 155 E H +E +I + N+T DL F + FG+ N ++ K Sbjct: 369 EFHQVEGVICDRNITLGDLIGFLEVFFGKMNVKNLRFK 406 >SPBC947.13 |rba50||RNA polymerase II associated protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 78 NLTGRDLEEFNRIHFGRRNNLEIKLKESSI 167 NL + ++E NR+ R N+LEI+ + I Sbjct: 74 NLDDQGIDEENRVRLERMNDLEIEGAQEEI 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,051,794 Number of Sequences: 5004 Number of extensions: 15040 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 77794588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -