BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0707 (853 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC530.02 |||membrane transporter|Schizosaccharomyces pombe|chr... 27 2.6 SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 26 7.8 >SPBC530.02 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 541 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 663 IVFGIKTADSXTPVN--HYQIVVSNRDAVVFPEDR 565 I GI A + TP+ HY V + R+ V+ PEDR Sbjct: 374 IGIGIVLAGACTPIIYVHYNRVYTRRNGVMSPEDR 408 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 25.8 bits (54), Expect = 7.8 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +1 Query: 574 WKYY-GITVTDDNLVVIDWRXGVRRL---YPKNDVMSH 675 W Y GI V DD + + DWR + P +++M H Sbjct: 317 WNYLSGIAVLDDRIAMHDWRLDLASFDIHGPDSNIMLH 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,013,102 Number of Sequences: 5004 Number of extensions: 55040 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -