BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0702 (742 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC014431-1|AAH14431.2| 146|Homo sapiens CYB5B protein protein. 31 5.7 BC004373-1|AAH04373.1| 146|Homo sapiens CYB5B protein protein. 31 5.7 AB009282-1|BAA23735.1| 146|Homo sapiens cytochrome b5 protein. 31 5.7 >BC014431-1|AAH14431.2| 146|Homo sapiens CYB5B protein protein. Length = 146 Score = 30.7 bits (66), Expect = 5.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 238 FPREASGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYV 363 F E GG E L G D +E+FE +S ++L++YY+ Sbjct: 51 FLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYI 92 >BC004373-1|AAH04373.1| 146|Homo sapiens CYB5B protein protein. Length = 146 Score = 30.7 bits (66), Expect = 5.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 238 FPREASGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYV 363 F E GG E L G D +E+FE +S ++L++YY+ Sbjct: 51 FLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYI 92 >AB009282-1|BAA23735.1| 146|Homo sapiens cytochrome b5 protein. Length = 146 Score = 30.7 bits (66), Expect = 5.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 238 FPREASGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYV 363 F E GG E L G D +E+FE +S ++L++YY+ Sbjct: 51 FLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYI 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,851,166 Number of Sequences: 237096 Number of extensions: 2204403 Number of successful extensions: 8925 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8925 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -