BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0701 (492 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45041| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.073 SB_32117| Best HMM Match : DUF1143 (HMM E-Value=7.7) 29 2.1 >SB_45041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 33.9 bits (74), Expect = 0.073 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = +1 Query: 157 PKREDYELVEFVXPPLI--DGEVLVKAEWISVDPY 255 P E++ VE V PPL+ GE+LVK ++SVDPY Sbjct: 21 PSLENFA-VEPVEPPLVCEQGEILVKTLYLSVDPY 54 >SB_32117| Best HMM Match : DUF1143 (HMM E-Value=7.7) Length = 755 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 58 LSGSACDKKTQGTTKVEMTSARKYVVXXHFKGVP 159 L G D +G+ K S+R + + +FKG+P Sbjct: 693 LEGKEADSDDEGSLKDNRRSSRSFSIKNYFKGIP 726 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,786,421 Number of Sequences: 59808 Number of extensions: 177922 Number of successful extensions: 255 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -