BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0701 (492 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D49387-1|BAA08382.1| 311|Homo sapiens NADP dependent leukotrien... 46 5e-05 BC035228-1|AAH35228.1| 329|Homo sapiens leukotriene B4 12-hydro... 46 5e-05 AL135787-5|CAC22152.1| 70|Homo sapiens leukotriene B4 12-hydro... 46 5e-05 AL135787-4|CAI12402.1| 119|Homo sapiens leukotriene B4 12-hydro... 46 5e-05 AL135787-3|CAC22151.1| 329|Homo sapiens leukotriene B4 12-hydro... 46 5e-05 >D49387-1|BAA08382.1| 311|Homo sapiens NADP dependent leukotriene b4 12-hydroxydehydrogenase protein. Length = 311 Score = 46.4 bits (105), Expect = 5e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +1 Query: 109 MTSARKYVVXXHFKGVPKREDYELVEFVXPPLIDGEVLVKAEWISVDPY 255 M + + + HF G P D+EL PPL +GEVL++A +++VDPY Sbjct: 1 MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPY 49 >BC035228-1|AAH35228.1| 329|Homo sapiens leukotriene B4 12-hydroxydehydrogenase protein. Length = 329 Score = 46.4 bits (105), Expect = 5e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +1 Query: 109 MTSARKYVVXXHFKGVPKREDYELVEFVXPPLIDGEVLVKAEWISVDPY 255 M + + + HF G P D+EL PPL +GEVL++A +++VDPY Sbjct: 1 MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPY 49 >AL135787-5|CAC22152.1| 70|Homo sapiens leukotriene B4 12-hydroxydehydrogenase protein. Length = 70 Score = 46.4 bits (105), Expect = 5e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +1 Query: 109 MTSARKYVVXXHFKGVPKREDYELVEFVXPPLIDGEVLVKAEWISVDPY 255 M + + + HF G P D+EL PPL +GEVL++A +++VDPY Sbjct: 1 MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPY 49 >AL135787-4|CAI12402.1| 119|Homo sapiens leukotriene B4 12-hydroxydehydrogenase protein. Length = 119 Score = 46.4 bits (105), Expect = 5e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +1 Query: 109 MTSARKYVVXXHFKGVPKREDYELVEFVXPPLIDGEVLVKAEWISVDPY 255 M + + + HF G P D+EL PPL +GEVL++A +++VDPY Sbjct: 1 MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPY 49 >AL135787-3|CAC22151.1| 329|Homo sapiens leukotriene B4 12-hydroxydehydrogenase protein. Length = 329 Score = 46.4 bits (105), Expect = 5e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +1 Query: 109 MTSARKYVVXXHFKGVPKREDYELVEFVXPPLIDGEVLVKAEWISVDPY 255 M + + + HF G P D+EL PPL +GEVL++A +++VDPY Sbjct: 1 MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPY 49 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,603,649 Number of Sequences: 237096 Number of extensions: 803809 Number of successful extensions: 1119 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4423060356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -