BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0701 (492 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010646-1|CAA09303.1| 1237|Caenorhabditis elegans calcium ATPas... 27 9.8 AC025724-13|AAK68551.1| 1234|Caenorhabditis elegans Membrane cal... 27 9.8 AC025724-12|AAK68550.1| 1160|Caenorhabditis elegans Membrane cal... 27 9.8 AC025724-11|AAM97979.1| 1137|Caenorhabditis elegans Membrane cal... 27 9.8 >AJ010646-1|CAA09303.1| 1237|Caenorhabditis elegans calcium ATPase protein. Length = 1237 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 49 TQSLSGSACDKKTQGTTKVEMTSARKYVVXXHFKGVPKREDYE 177 T + + C KT T MT + +V H+K PK E + Sbjct: 422 TMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLD 464 >AC025724-13|AAK68551.1| 1234|Caenorhabditis elegans Membrane calcium atpase protein3, isoform b protein. Length = 1234 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 49 TQSLSGSACDKKTQGTTKVEMTSARKYVVXXHFKGVPKREDYE 177 T + + C KT T MT + +V H+K PK E + Sbjct: 422 TMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLD 464 >AC025724-12|AAK68550.1| 1160|Caenorhabditis elegans Membrane calcium atpase protein3, isoform a protein. Length = 1160 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 49 TQSLSGSACDKKTQGTTKVEMTSARKYVVXXHFKGVPKREDYE 177 T + + C KT T MT + +V H+K PK E + Sbjct: 422 TMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLD 464 >AC025724-11|AAM97979.1| 1137|Caenorhabditis elegans Membrane calcium atpase protein3, isoform c protein. Length = 1137 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 49 TQSLSGSACDKKTQGTTKVEMTSARKYVVXXHFKGVPKREDYE 177 T + + C KT T MT + +V H+K PK E + Sbjct: 422 TMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYKDTPKIESLD 464 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,754,485 Number of Sequences: 27780 Number of extensions: 124593 Number of successful extensions: 223 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 924715866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -