BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0701 (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36690.1 68415.m04501 oxidoreductase, 2OG-Fe(II) oxygenase fa... 30 0.74 At1g55970.1 68414.m06419 histone acetyltransferase 4 (HAC4) simi... 29 2.2 At2g39980.1 68415.m04913 transferase family protein contains Pfa... 28 3.0 At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative... 27 6.9 At5g01210.1 68418.m00026 transferase family protein contains Pfa... 27 9.1 >At2g36690.1 68415.m04501 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to IDS3 [Hordeum vulgare][GI:4514655], leucoanthocyanidin dioxygenase [SP|P51091][Malus domestica]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 366 Score = 30.3 bits (65), Expect = 0.74 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 151 GVPKREDYELVEFVXPPLIDG-EVLVKAEWISVDPY*G 261 G+P DY + + ++G ++L + EW++VDP G Sbjct: 235 GMPPHSDYGFLTLLLQDEVEGLQILYRDEWVTVDPIPG 272 >At1g55970.1 68414.m06419 histone acetyltransferase 4 (HAC4) similar to CREB-binding protein GB:AAC51770 GI:2443859 from [Homo sapiens]; contains Pfam PF02135: TAZ zinc finger profile; contains Pfam PF00569: Zinc finger, ZZ type domain; identical to histone acetyltransferase HAC4 (GI:14794966) {Arabidopsis thaliana} Length = 1456 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +2 Query: 47 SLSHSLEARVIRKLKELRKSR*PQQGST 130 SLS LE R+ +KLKE R+ R QG T Sbjct: 866 SLSKHLEERLFKKLKEERQERARLQGKT 893 >At2g39980.1 68415.m04913 transferase family protein contains Pfam profile PF02458 transferase family Length = 482 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -1 Query: 312 PLDN*XGRRVQLGKSCKPLIRVDADPFGFNEDLAVDQRRXNKFD 181 PL N G V +G S P + + FG+ +AV R NKFD Sbjct: 399 PLGNADGASVTMGSS--PRFPMYDNDFGWGRPVAVRSGRSNKFD 440 >At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 345 Score = 27.1 bits (57), Expect = 6.9 Identities = 18/60 (30%), Positives = 24/60 (40%) Frame = +3 Query: 231 RMDQRRPVLRAYNSYQAVPYDXFSYQVGVVVXSRXSNYPVGXRVVAHKGWCDHYVFTPST 410 RM + P A A F Y V V+ S +Y G + GW ++ V TP T Sbjct: 57 RMGKPDPSTAALAQAYAPGKPIFGYGVSRVIESGHPDYKKGDLLWGIVGWEEYSVITPMT 116 >At5g01210.1 68418.m00026 transferase family protein contains Pfam profile PF02458 transferase family Length = 475 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 312 PLDN*XGRRVQLGKSCKPLIRVDADPFGFNEDLAVDQRRXNKFD 181 PL N G + +G S P + + FG+ + LAV NKFD Sbjct: 388 PLGNPDGASITMGSS--PRFPMYDNDFGWGKPLAVRSGGANKFD 429 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,336,021 Number of Sequences: 28952 Number of extensions: 115302 Number of successful extensions: 171 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -