BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0693 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase pr... 23 6.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.6 >Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase protein. Length = 247 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 344 CGCIIKKMRIVGIRPRSVRRF 282 CG +++RIVG RP V ++ Sbjct: 1 CGAANQEIRIVGGRPTGVNQY 21 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 6.6 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +3 Query: 258 ISGRGHDSKPSNTPGPNAYDPHLLDNTPTFTFSGRGHDSKPSDTPGPNAYDPHLMDGTP 434 +S H S S+ GP P ++ +TP+ + + K +D PG A H +P Sbjct: 1338 LSQSSHHSSSSHG-GPT---PSIISHTPSLSSASGSIGPKSADQPGAAAGLHHQQPSSP 1392 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,244 Number of Sequences: 2352 Number of extensions: 18220 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -