BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0689 (720 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0890 + 7014131-7014168,7014443-7014532,7015468-7015698,701... 31 1.2 05_06_0012 + 24844413-24844913 28 6.5 >01_01_0890 + 7014131-7014168,7014443-7014532,7015468-7015698, 7015931-7015944,7016569-7016925,7017033-7017379 Length = 358 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Frame = -3 Query: 478 DNGIKQV*LKKNNTKQPKKLYNNYRLI-----RRKTHEVKG--TIRCAQCKSSKWVI*PV 320 +N I + +KK+ + K + N L+ RR +E+K R +CK+++W++ P Sbjct: 93 ENSILEKYIKKHGERNWKLVQKNTGLLSFCITRRTDNEIKNYWNTRIKKCKNNRWLLYPA 152 Query: 319 MVC 311 VC Sbjct: 153 NVC 155 >05_06_0012 + 24844413-24844913 Length = 166 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 318 ITGQMTHFELLHCAHLIVPLTS*-VFLRINL*LLYNFFGCFVLFFFSYTCFIPLSTCYG 491 + G TH L C +L++ S +FL ++L LL + G ++F + T + + C G Sbjct: 1 MAGVHTHRAFLLCNYLLLGAASGCIFLTLSLRLLPSPCGLLLVFLHALTAVLAAAACSG 59 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,662,129 Number of Sequences: 37544 Number of extensions: 259839 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -