BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0688 (666 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 99 2e-23 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 99 bits (238), Expect = 2e-23 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 666 GIXEXTYNSXMKCDVDIRRDLYANTVLSGGTPMYPGIADRMQXEITVLAPSTIRLR 499 GI E TYNS MKCDVDIR+DLYANTVLSGGT MYPGIADRMQ EIT LAPST++++ Sbjct: 48 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 103 Score = 72.1 bits (169), Expect = 4e-15 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 520 PIDNKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 410 P KIKIIAPPE+KYSVWIGGSILASLSTFQQMWIS Sbjct: 97 PSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,219 Number of Sequences: 438 Number of extensions: 3243 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -