BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0686 (841 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 3.5 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 3.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 6.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.1 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 6.1 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.0 bits (47), Expect = 3.5 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 173 YILGMSCLIIMMLLTFNYYYFYILL 99 Y+LG+ CL ++ L +++ ILL Sbjct: 381 YLLGIQCLTVVCLAFWSFIVSTILL 405 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 3.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 640 PAHGXIPRPGFPPPLTIKKIL 702 P G +P P P P T++++L Sbjct: 151 PRGGSLPTPVTPTPTTVQQLL 171 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 6.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 229 KRLSDYYYYYTVH 191 KR+ DYY+ Y +H Sbjct: 423 KRIIDYYHSYKMH 435 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 6.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 229 KRLSDYYYYYTVH 191 KR+ DYY+ Y +H Sbjct: 423 KRIIDYYHSYKMH 435 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 6.1 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 441 IKTLDAKRAAGELASF*LCY*RYCVSKGTSCKLIAFD 331 + TL + GELA C ++ T C+L A D Sbjct: 156 LSTLAPGKVLGELAILYNCKRTATITAATDCQLWAID 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,165 Number of Sequences: 438 Number of extensions: 4515 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26945694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -