BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0684 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC965.04c |||mitochondrial inner membrane i-AAA protease compl... 29 0.77 SPCC622.13c |||conserved eukaryotic protein|Schizosaccharomyces ... 27 3.1 SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom... 26 5.4 SPAC27E2.05 |cdc1|mis1|DNA polymerase delta small subunit Cdc1|S... 25 9.5 >SPCC965.04c |||mitochondrial inner membrane i-AAA protease complex subunit Yme1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 709 Score = 29.1 bits (62), Expect = 0.77 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 407 FTADEVKFRCAIPECDTPTPSFNATWTAFALPNTPIPATEWAPLL 541 F+A KF + TPS N + P+TP P WAP + Sbjct: 145 FSAGVPKFTSDTSSTVSSTPSLNHSLQNSMPPSTPTPPPVWAPTI 189 >SPCC622.13c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1098 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 654 SQPQCSXRVEVLRLQVYGGSALLGNDCTFCPVL 556 S Q + RVE+L+L YG + L TF P + Sbjct: 838 SHEQITIRVEMLKLLSYGSNVLAKEPNTFYPAI 870 >SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 641 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 534 GAHSVAGIGVFGKANAVHVALKLGVGVSHSGIA 436 GA+S+ I VFG+A A+H+ L H +A Sbjct: 447 GANSLLDIVVFGRACALHIKDTLEPNTPHKPLA 479 >SPAC27E2.05 |cdc1|mis1|DNA polymerase delta small subunit Cdc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 462 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 613 QPEYFDAXRTLGLRXTSVRGLQ*H 684 QPEY A LGL + G+Q H Sbjct: 182 QPEYIAAVSGLGLSNDGIEGIQVH 205 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,831,328 Number of Sequences: 5004 Number of extensions: 53845 Number of successful extensions: 143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -