Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0684
         (800 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK125301-1|BAC86119.1|  222|Homo sapiens protein ( Homo sapiens ...    32   2.1  

>AK125301-1|BAC86119.1|  222|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43311 fis, clone NT2RI2009855. ).
          Length = 222

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%)
 Frame = +2

Query: 509 PIPATEWAPLLEDRFNRTGQNVQSLPNKADPPYTCSLSTS-TRXEHWGCDXLVYEDYNSM 685
           P PAT +  L+E  F+  GQ    L    DPP + S     T   H G    ++ + N  
Sbjct: 58  PCPATFFVFLVETGFHHVGQAGLKLLTSGDPPASASQRAGITGVSHHGQPSFIFMEKNIS 117

Query: 686 LAEF 697
           L E+
Sbjct: 118 LYEY 121


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,233,448
Number of Sequences: 237096
Number of extensions: 1929199
Number of successful extensions: 7619
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7349
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7619
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9869080686
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)