BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0676 (576 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 6.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.6 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 409 VLADWVXRDRGFLNFSGNAD 468 V A W+ D+GFL G D Sbjct: 161 VPAGWIWGDQGFLKKLGAVD 180 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 6.6 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Frame = -1 Query: 183 EGDGAVSSDRPDRDRALRTSQRRDVTLKEPNVSIT--IADFRNP-----FRKHKYETIQH 25 + DGAVS R ++DR R + T + T +A R P R K E +Q Sbjct: 307 DADGAVSPLRREKDRGSREYPTSNATDTDGTKERTEEVALDRTPVTQGLLRVKKEEELQE 366 Query: 24 AELC 13 A C Sbjct: 367 APSC 370 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,179 Number of Sequences: 438 Number of extensions: 1732 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -