BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0674 (480 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1375 + 33040329-33040854,33041611-33041838,33041984-330420... 30 1.1 >04_04_1375 + 33040329-33040854,33041611-33041838,33041984-33042081, 33042406-33042450,33042678-33042846,33042917-33043026, 33043983-33044051,33044085-33044158,33044738-33044804, 33044876-33044988,33045148-33045237,33046030-33046144, 33046230-33046388 Length = 620 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -1 Query: 210 FSXLKVRNSCXLVNVIRXVNGIAS-LEASPELWNTQTTASMRLWERSKTRRHLCKIELHF 34 F LKVR + N + S ++ + +TT++ W+R LCK+ H+ Sbjct: 412 FCDLKVRRQYPEFTICYVTNKLMSFIKRREQNQYNKTTSNSNSWKRPPVEEALCKLATHY 471 Query: 33 *NTREKY 13 R ++ Sbjct: 472 ARVRSRH 478 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,667,329 Number of Sequences: 37544 Number of extensions: 168970 Number of successful extensions: 373 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -