Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0674
         (480 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40458| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.1  
SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.0  

>SB_40458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 27.5 bits (58), Expect = 6.1
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = +3

Query: 405  LQXFNTSRNPKGWIW 449
            LQ F TSR P  WIW
Sbjct: 1053 LQNFTTSRTPFNWIW 1067


>SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2848

 Score = 27.1 bits (57), Expect = 8.0
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = +3

Query: 27   YSKNAILFYKDDVESWNAPTTASMQLFEYSKAPDLP 134
            Y +  I F+     SW++       LFE  K PD P
Sbjct: 903  YFRRVISFHSVGGTSWDSSVADEEDLFEVKKKPDKP 938


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,376,371
Number of Sequences: 59808
Number of extensions: 197118
Number of successful extensions: 404
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 404
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1001731762
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)