BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0672 (786 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.05 |trs31||TRAPP complex subunit Trs31 |Schizosaccharom... 29 0.76 SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 7.0 >SPBC1718.05 |trs31||TRAPP complex subunit Trs31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 209 Score = 29.1 bits (62), Expect = 0.76 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 208 PRSYSIIPCTKYSSSILARFEHSNXFKVKLSAHLDTXX*APYRILIL 348 P+ + + C Y + I+ F S F K SAH PYR +IL Sbjct: 148 PKEMNQLNCCAYLAGIIEGFLDSAQFPCKASAHSVPLSQYPYRTVIL 194 >SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 25.8 bits (54), Expect = 7.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 433 AAHKCNYELFNRNNFSIRYWSWNYRAA 513 AA KC +E FSI + S+N++++ Sbjct: 73 AASKCEFEKIWSTTFSISFLSFNFKSS 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,714,955 Number of Sequences: 5004 Number of extensions: 47926 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -