BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0672 (786 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.6 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 7.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 7.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 9.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 9.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 9.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 9.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 9.8 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.8 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 113 RRKTNISESICQRCFHQ 63 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 668 SKEGSRRANYPLPARGGSDEK*RYG 594 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.8 bits (44), Expect = 7.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 124 NXWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 2 N +VAR A F V IN+ + R+ L+ T+N Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 700 ESXPDFPVNRGQPWVVAETTIKVXK 774 ES FP G P+V IK+ K Sbjct: 923 ESVHSFPTETGLPFVYTFNVIKLTK 947 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 204 RTEIIFYYSMHEIFKQHFSP 263 ++E I Y MH+I K+ SP Sbjct: 257 KSEPIDAYEMHQISKKKLSP 276 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 430 SAAHKCNYELFNRNNFSIRYWSWNY 504 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 430 SAAHKCNYELFNRNNFSIRYWSWNY 504 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 430 SAAHKCNYELFNRNNFSIRYWSWNY 504 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 430 SAAHKCNYELFNRNNFSIRYWSWNY 504 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 430 SAAHKCNYELFNRNNFSIRYWSWNY 504 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -2 Query: 581 PRNRNEYTLNXLTRNNW 531 PRN +EY N L W Sbjct: 368 PRNIDEYNNNDLDTKKW 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,795 Number of Sequences: 438 Number of extensions: 3996 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -