BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0669 (768 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23519-9|ABS19470.1| 203|Caenorhabditis elegans Hypothetical pr... 29 2.8 U39999-6|AAA81107.2| 198|Caenorhabditis elegans Hypothetical pr... 29 3.6 >U23519-9|ABS19470.1| 203|Caenorhabditis elegans Hypothetical protein F26G1.11 protein. Length = 203 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -3 Query: 271 IEPAFLERRLTDDMSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRY 128 IE + R +++ +N++V + SA HK NYEL +F +RY Sbjct: 85 IEHGCTKGRSEEEIQSNINVYSEFPISLSALHKHNYEL--NQDFELRY 130 >U39999-6|AAA81107.2| 198|Caenorhabditis elegans Hypothetical protein F41G3.10 protein. Length = 198 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 231 CPQTCQYHRGCGAPTARRTNATTSFL 154 CP+TC Y G G T RT+ T + L Sbjct: 133 CPRTCGYCSGSGVVTTTRTSTTCADL 158 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,620,605 Number of Sequences: 27780 Number of extensions: 327332 Number of successful extensions: 652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -