BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0665 (848 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.25 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.7 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.25 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 78 TAIPPPSKVAPQCGKPANAAPTKRYL 155 T IPPP+ V P+ KP+ +Y+ Sbjct: 1084 TTIPPPAVVMPEVDKPSQPCEPGQYV 1109 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -3 Query: 528 VQIMTRRVGYMSQWVESSSRICFVAGL*RGNSRVRNRQYF 409 V ++ VG+ +V +S + F+ L + + R YF Sbjct: 15 VSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYF 54 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 90 PPSKVAPQCGKPANAAPTKRYLLSIGRIFH 179 P + +A QC K +N +P ++G+ FH Sbjct: 36 PLAMLAAQCNKLSNKSPPPLADAAVGKGFH 65 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -3 Query: 528 VQIMTRRVGYMSQWVESSSRICFVAGL*RGNSRVRNRQYF 409 V ++ VG+ +V +S + F+ L + + R YF Sbjct: 248 VSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYF 287 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -3 Query: 528 VQIMTRRVGYMSQWVESSSRICFVAGL*RGNSRVRNRQYF 409 V ++ VG+ +V +S + F+ L + + R YF Sbjct: 248 VSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYF 287 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 91 HHPKWPHSAGNQPTQHP 141 HH +W +S N Q+P Sbjct: 72 HHGQWNYSPDNHFEQYP 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,744 Number of Sequences: 336 Number of extensions: 4423 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -