BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0665 (848 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0209 + 23607749-23607893,23607990-23608043,23608156-236084... 30 2.7 11_01_0248 - 1910312-1910730,1910805-1911336 29 6.2 07_01_0552 + 4109906-4109983,4110422-4110484,4110496-4110525,411... 29 6.2 >04_04_0209 + 23607749-23607893,23607990-23608043,23608156-23608433, 23609524-23609894,23610033-23610096,23610472-23610603 Length = 347 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = -1 Query: 296 RTCRGSVRGNDNGXYIEWRIWMSGSVSSDGDGRPDQRKFVEDPPNREQI 150 RT G + G G +I R+ G++++ G G+P R+F+ N+E + Sbjct: 79 RTALGELSGG-GGFFIR-RVASPGALAARGPGKPLARRFIRPSNNKENV 125 >11_01_0248 - 1910312-1910730,1910805-1911336 Length = 316 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 479 RLREFVSLPDCREAIVESGTASISEAQLVRNHCRRAYKCNDPCSSSSKF 333 R+ + SLP+ R + + S+ ++ + + C+ Y C DP +SS+F Sbjct: 125 RIPDLSSLPEPRLLMTHIPSQSLPDS-VAASGCKVVYLCRDPWIASSRF 172 >07_01_0552 + 4109906-4109983,4110422-4110484,4110496-4110525, 4110567-4110621,4111046-4111143,4112259-4112417, 4112518-4112577,4113436-4113624,4113749-4113802, 4113959-4114045,4114149-4114881,4115282-4115373, 4115739-4115812,4116097-4116199,4116342-4117204, 4117649-4117724,4117861-4117972,4118092-4118168, 4118272-4118352,4118710-4118789,4118860-4118875 Length = 1059 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = +2 Query: 272 HAPXHDTYEVSWVSFTTEKLETYYWNYMDHYICTRGDSDFALVEPLKYWRFRTLLLPLYN 451 H H + S+ S T + ++ D +C A ++PL RF ++L+P++ Sbjct: 843 HQEEHGISDSSYASLATSAADAFHVMMSDSEVCLN-KKFHARIKPLYKQRFFSILMPIFL 901 Query: 452 PATKQ 466 K+ Sbjct: 902 SKIKE 906 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,990,243 Number of Sequences: 37544 Number of extensions: 525119 Number of successful extensions: 1746 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1744 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -