BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0665 (848 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26900.1 68415.m03227 bile acid:sodium symporter family prote... 31 0.97 At5g67120.1 68418.m08462 zinc finger (C3HC4-type RING finger) fa... 31 1.3 At4g16670.1 68417.m02518 expressed protein 30 2.2 At5g66770.1 68418.m08416 scarecrow transcription factor family p... 29 3.0 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 28 6.8 At2g25980.1 68415.m03120 jacalin lectin family protein similar t... 28 9.0 >At2g26900.1 68415.m03227 bile acid:sodium symporter family protein low similarity to SP|Q12908 Ileal sodium/bile acid cotransporter {Homo sapiens}; contains Pfam profile PF01758: Sodium Bile acid symporter family Length = 409 Score = 31.1 bits (67), Expect = 0.97 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 145 SVICSRLGGSSTNLRWSGLPSPSLDTD 225 SV+C LGGS + W LP P+ D D Sbjct: 379 SVVCMALGGSGLAVFWRNLPIPADDKD 405 >At5g67120.1 68418.m08462 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 272 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 65 SLCVNGDSPTIQSGPTVRETSQRSTHQALSALDWED 172 +L VNGD P I+ G +R S +T + S W D Sbjct: 45 TLDVNGDGPAIEPGSLLRTISWETTFEQDSLQSWND 80 >At4g16670.1 68417.m02518 expressed protein Length = 429 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +3 Query: 39 VNENEVIESHCASTAIPPPSKVAP-QCGKPANAAPTKRYLLSIGRIFHKLTLVGSTITVT 215 +N+N I T++ P + P Q GK A+A +R +IG+ FH VG ++ Sbjct: 92 LNKNPNISQLADVTSLAPVAPPPPLQTGKLASAVHARR-TGTIGKWFHHREFVGGKVSAV 150 Query: 216 RYRPR 230 + R R Sbjct: 151 KKRDR 155 >At5g66770.1 68418.m08416 scarecrow transcription factor family protein Length = 584 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 151 ICSRLGGSSTNLRWSGLPSPSLDTDPD 231 + +R G T +R SG+P+PSL P+ Sbjct: 340 LATRTSGKPTQIRVSGIPAPSLGESPE 366 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 151 ICSRLGGSSTNLRWSGLPSPSLDTDP 228 + +R G T +R SG+P+PSL P Sbjct: 294 LATRSSGKPTRIRISGIPAPSLGDSP 319 >At2g25980.1 68415.m03120 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 449 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 203 GRPDQRKFVEDPPNREQITLGGCCVGWFPALWGHFG 96 GR +R FV + R + L G C AL HFG Sbjct: 258 GRKSERTFVFESKGRALVGLHGRCCWAIDALGAHFG 293 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,756,656 Number of Sequences: 28952 Number of extensions: 400161 Number of successful extensions: 1214 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1213 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -